Protein coding transcript 29873

• Transcript: Ll_transcript_315514
• CDS coordinates: 454-1509 (+)
• Peptide sequence: MVKVTQIQNDFPIGSCINRTNIDNEDFVDFFLNHFNWAVFGNELKWYWTEPQKGNFNYKDADDMLDLCQKNNINTRGHCIFWEVDGTVQQWIKSLNKTDLMTAVQNRLSGLLTRYKGKFKHYDVNNEMLHGSFYQDKLGKDIRGNMFKTAHQLDSSATLFVNDYHVEDGCDTRSSPEKYIQQITDLQGQGAPVGGIGIQGHIDSPVGPIVCSALDKLGTLGLPIWFTELDVSSTNEYVRADDLEVMLREAMAHPSIEGIMLWGFWELFMSRDNSHLVNAEGSINEAGKRFLALKKEWLSHSHGLVDEQGYFTFRGFNGKYNVEVVTLTKEISKTFVVVDNGDSPLVVSIDL*
• ORF Type: complete

Annotations of Ll_transcript_315514

• Blastp: Anti-sigma-I factor RsgI6 from Ruminiclostridium with 41.52% of identity
• Blastx: Anti-sigma-I factor RsgI6 from Ruminiclostridium with 40.51% of identity
• Eggnog: NA(ENOG41123G8)
• Kegg: Link to kegg annotations (Cthe_2119)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416622.1)
• Pfam: Glycosyl hydrolase family 10 (PF00331.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;