Protein coding transcript 29955

• Transcript: Ll_transcript_512241
• CDS coordinates: 129-665 (+)
• Peptide sequence: MATSKAAISSLTHLRHLTCAASASSSYPARLVPDPPNLIAWVTREGGYVHPAVKIAHSHHFNGLGLVADQQIPTGTDLIILPDHIPLSFRSFESEDSVDSALAQLARQVPEELWAMKLGLKLLQERAKLGSFWWPYISNLPQTYSVPIFFPGEDIKNLQYAPVLHQVLYSKLLKLIYD*
• ORF Type: complete

Annotations of Ll_transcript_512241

• Blastp: Histone-lysine N-methyltransferase setd3 from Gallus with 30.08% of identity
• Blastx: Histone-lysine N-methyltransferase setd3 from Gallus with 30.08% of identity
• Eggnog: set domain containing(ENOG410Y7DR)
• Kegg: Link to kegg annotations (423445)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446217.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;