Protein coding transcript 300

• Transcript: Ll_transcript_328665
• CDS coordinates: 1-357 (+)
• Peptide sequence: PDVYRIWMPDDDCPGLAMSRAFGDFCLKDYGLISAPDVFYRKLTKQDQFVVLASDGVWDVLTNSEVINIVASAPRRSIAAKILVKRAVRAWRYKYPGSKVDDCAAICLFVDDNPVLSQS
• ORF Type: internal

Annotations of Ll_transcript_328665

• Blastp: Probable protein phosphatase 2C 65 from Arabidopsis with 65.79% of identity
• Blastx: Probable protein phosphatase 2C 65 from Arabidopsis with 65.79% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT5G01700)
• CantataDB: Link to cantataDB annotations (CNT0001601)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450538.1)
• Pfam: Protein phosphatase 2C (PF00481.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;