| Transcript | Ll_transcript_512443 |
|---|---|
| CDS coordinates | 488-949 (+) |
| Peptide sequence | MDDDSTARLVWHAYNLKKLDIPRSRWGCQITDAGLCRISFAKCVSNLTSISLWGLTGITDEGVVQLISRTTSLKHLNVGGTFITDESLFVIANSCPNLETIVLWSCRHVTDSGLIALVEKCLKIKSINVWGTRVPVDSLANLLILNPSLQIKL* |
| ORF Type | complete |
| Blastp | F-box protein At5g67140 from Arabidopsis with 69.08% of identity |
|---|---|
| Blastx | F-box protein At5g67140 from Arabidopsis with 67.39% of identity |
| Eggnog | F-box and leucine-rich repeat protein(ENOG410XQ54) |
| Kegg | Link to kegg annotations (AT5G67140) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019423356.1) |
| Pfam | - |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer