Protein coding transcript 30195

• Transcript: Ll_transcript_511758
• CDS coordinates: 313-780 (+)
• Peptide sequence: MTNMGDKGEKSCPICTEEMDLTDQQLKPCKCGYEICVWCWHHIIEMAQKDETEGRCPACRSPYDKERIEAMAANCKRLVAEMNSKYKRKMQKLKPKPSEGRKHLTDVRVIQRKLVYIIGLPLNLAHEDVSTSMLFCISILLWSMAGILHMFKASF*
• ORF Type: complete

Annotations of Ll_transcript_511758

• Blastp: General negative regulator of transcription subunit 4 from Saccharomyces with 37.23% of identity
• Blastx: General negative regulator of transcription subunit 4 from Saccharomyces with 28.3% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YER068W)
• CantataDB: Link to cantataDB annotations (CNT0002474)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443043.1)
• Pfam: RING/Ubox like zinc-binding domain (PF14570.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;