Protein coding transcript 30240

• Transcript: Ll_transcript_513558
• CDS coordinates: 190-1020 (+)
• Peptide sequence: MVEIEFQETDENEHTAIPPKSAATAAAKSSTSDVDTGKEASDGFETASDAELGSEDGGDGGDAVEEQPRQQGQEQDQDQKQVVRDASDDVSNSEELIQKGLAQANERKLEGNKFFGEGKYEEALSQYELALQVAPDVPSSVEVRSICHSNRAVCFLKLGKYEDTIKECAKALELNPVYVKALVRRGEAHEKLEHYDEAIADMKKIIEVDPSNDQAKKVIRRLEPLAAEKREKMKEEMIGKLKEMGNSVLGRFGMSVDNFKAVKDPNTGSYSISFQR*
• ORF Type: complete

Annotations of Ll_transcript_513558

• Blastp: Tetratricopeptide repeat protein 1 from Homo with 40.93% of identity
• Blastx: Tetratricopeptide repeat protein 1 from Homo with 45.6% of identity
• Eggnog: Tetratricopeptide repeat(ENOG4111IF0)
• Kegg: Link to kegg annotations (7265)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464068.1)
• Pfam: Tetratricopeptide repeat (PF00515.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;