Transcript | Ll_transcript_513563 |
---|---|
CDS coordinates | 1-324 (+) |
Peptide sequence | VLPAIRNVNNPGRGGFGRGRWQPGHQNDRGAGLLPRPGPYPHRQNFGYGNRFQNGHRDERFVSDMKLTKSEETLSRKCIAFQEVGKRPFPVFYCCCCIEQFNVILFK* |
ORF Type | 5prime_partial |
Blastp | Decapping nuclease DXO homolog, chloroplastic from Arabidopsis with 58.14% of identity |
---|---|
Blastx | Decapping nuclease DXO homolog, chloroplastic from Arabidopsis with 78.48% of identity |
Eggnog | Ribonuclease that specifically degrades pre-mRNAs with a defective 5' end cap and is part of a pre-mRNA capping quality control. Has decapping and pyrophosphohydrolase activities. Has decapping activity toward incomplete 5' end cap mRNAs such as unmethylated 5' end-capped RNA to release GpppN and 5' end monophosphate RNA. Also possesses RNA 5'-pyrophosphohydrolase activity by hydrolyzing the 5' end triphosphate to release pyrophosphates(ENOG410ZAFR) |
Kegg | Link to kegg annotations (AT4G17620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422194.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer