Protein coding transcript 30379

• Transcript: Ll_transcript_513756
• CDS coordinates: 337-981 (+)
• Peptide sequence: MKIVSFSSGIVDLLKEAMMLIAPIMIGVLVGWAWKPKWANPIKWFSNFFNFLFLSLSPLTPTHSPSYSTATSSGAQVEKDDSNSSLTEQDLAHLCKLVDEKDDGPVWIEMMDRSTPTMSFQAWRRDPENGPPQYRSSTVFEDASPELVRDFFWDDEFRSKWDDMLLHANTIQECPLTGTMIVQWVCKFPFFCSDREYVIGRRIWNSGQAYYCVTK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_513756

• Blastp: StAR-related lipid transfer protein 7, mitochondrial from Mus with 31.73% of identity
• Blastx: StAR-related lipid transfer protein 7, mitochondrial from Mus with 31.73% of identity
• Eggnog: StAR-related lipid transfer (START) domain containing(ENOG4111HC0)
• Kegg: Link to kegg annotations (99138)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452354.1)
• Pfam: START domain (PF01852.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;