Transcript | Ll_transcript_511401 |
---|---|
CDS coordinates | 628-1089 (+) |
Peptide sequence | MSFQQILEFLNFLYAVGMLLEFAAFIRLRLKKPDLHRPFKVPLGTFWVAMLCLPPALLLILVMCLASLRTFFVSGVVIMMGFILYPILVQAKSKNWIPFEAEPPSLQSNGSEGCHSVASELVHLENKDVDLVLSSPFVNVEELSLIQSDSKPN* |
ORF Type | complete |
Blastp | Probable polyamine transporter At3g19553 from Arabidopsis with 61.24% of identity |
---|---|
Blastx | Probable polyamine transporter At3g19553 from Arabidopsis with 65.79% of identity |
Eggnog | amino acid(COG0531) |
Kegg | Link to kegg annotations (AT3G19553) |
CantataDB | Link to cantataDB annotations (CNT0000235) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423123.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer