Protein coding transcript 30406

• Transcript: Ll_transcript_511401
• CDS coordinates: 628-1089 (+)
• Peptide sequence: MSFQQILEFLNFLYAVGMLLEFAAFIRLRLKKPDLHRPFKVPLGTFWVAMLCLPPALLLILVMCLASLRTFFVSGVVIMMGFILYPILVQAKSKNWIPFEAEPPSLQSNGSEGCHSVASELVHLENKDVDLVLSSPFVNVEELSLIQSDSKPN*
• ORF Type: complete

Annotations of Ll_transcript_511401

• Blastp: Probable polyamine transporter At3g19553 from Arabidopsis with 61.24% of identity
• Blastx: Probable polyamine transporter At3g19553 from Arabidopsis with 65.79% of identity
• Eggnog: amino acid(COG0531)
• Kegg: Link to kegg annotations (AT3G19553)
• CantataDB: Link to cantataDB annotations (CNT0000235)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423123.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;