Protein coding transcript 30423

• Transcript: Ll_transcript_511748
• CDS coordinates: 2-589 (+)
• Peptide sequence: KTKLTTMAFALHNNVVAIFSTLIFVIISFEVASGSHHHHHHHLKSLHFSLYQHETINKTGYIIVNGVEGGAGVTQTTTPFGTLFVFQDPLTATANRSSKLVGSSEGTSITSSFDGLQSISIAKLSLHLKNHKGSVSIVGGTHNIKPSDHPVVGGTGDFLFVQGYVTSSPVDLKGLTVTYKIEFHLYWPPYATQAS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_511748

• Blastp: Dirigent protein 19 from Arabidopsis with 28.49% of identity
• Blastx: Dirigent protein 23 from Arabidopsis with 31.9% of identity
• Eggnog: Disease resistance response protein(ENOG410YGJA)
• Kegg: Link to kegg annotations (AT1G58170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421391.1)
• Pfam: Dirigent-like protein (PF03018.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;