Protein coding transcript 3048

• Transcript: Ll_transcript_470425
• CDS coordinates: 134-793 (+)
• Peptide sequence: MFNILCVPLGLKRCGKSCRLRWLNYLRPHIKHGGFTDEEDRVICTLYATIGSRWSLIAAQLQGRTDNDVKNHWNTKLKKKFLAENNNIGTNNTSHMINNIDSPQFSTFTPQPQVEAFLFDHKNSPCYDPYILGLDQTPFPVPLSMPLELDVSGYETSMSNNCGIIPFSKEEKDNNNTQQWLGYEDGDAAMLLDFVYEDFLHNNGFVSQDKSSQIASSSI*
• ORF Type: complete

Annotations of Ll_transcript_470425

• Blastp: Transcription factor MYB87 from Arabidopsis with 72.62% of identity
• Blastx: Transcription factor MYB87 from Arabidopsis with 77.63% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT4G37780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446415.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;