Transcript | Ll_transcript_512895 |
---|---|
CDS coordinates | 44-613 (+) |
Peptide sequence | MTKVYPQQRTSSSNYMAYERETYTIWMKSLIFHSNGCTVYDSNGDIVYRVDNYDKKGTPQVNLMDLQGRVLCTIHKRFLGFGSWVVYKCKSDEKAWFQVKRCYKMMIMGKVTWQIMVGTQKYCIQRIKGKTAFRIINIDGDIVANAKQKHSSTGIVLGNDVLTLEVEADVDHSLIMAFVTVFGLICGRM* |
ORF Type | complete |
Blastp | Protein LURP-one-related 4 from Arabidopsis with 48.69% of identity |
---|---|
Blastx | Protein LURP-one-related 4 from Arabidopsis with 48.69% of identity |
Eggnog | LURP-one-related(ENOG410YJE2) |
Kegg | Link to kegg annotations (AT1G63410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423307.1) |
Pfam | LURP-one-related (PF04525.11) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer