Protein coding transcript 30589

• Transcript: Ll_transcript_511314
• CDS coordinates: 113-829 (+)
• Peptide sequence: MNDSDVSKQIDQMVKFIHQEAEEKANEISVSSEEEFNIEKLHLLEAEKKKIKQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDEVVNAMKEATAKELLTVSSHHYFDFTHHDHAYRNLIKDLIVQSLLRLKEPSVLLRCREHDLHLVKHVLDSSAEEFAEKANLDAPEIIVDENVFLPPAPSDDNIHEPHCSGGVVLASRDGKIVFENTLDARLDVLFRSKLPEIRKQLFGQVAA*
• ORF Type: complete

Annotations of Ll_transcript_511314

• Blastp: V-type proton ATPase subunit E3 from Arabidopsis with 73.11% of identity
• Blastx: V-type proton ATPase subunit E3 from Arabidopsis with 73.11% of identity
• Eggnog: Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity)(COG1390)
• Kegg: Link to kegg annotations (AT1G64200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422806.1)
• Pfam: ATP synthase (E/31 kDa) subunit (PF01991.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;