Protein coding transcript 30596

• Transcript: Ll_transcript_511324
• CDS coordinates: 192-560 (+)
• Peptide sequence: MNDSDVSRQIDQMVRFIHQEAEEKANEISVSAEEEFNIEKLQLLEAEKKKIKQEYERKEKQVEIRKKIEYSMQLNASRIKVLQAQDDVVNSMKDAASKELLVLSSNDTLYRNLLKDLIVQVS*
• ORF Type: complete

Annotations of Ll_transcript_511324

• Blastp: V-type proton ATPase subunit E from Cryophytum with 80.83% of identity
• Blastx: V-type proton ATPase subunit E from Citrus with 72.32% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446547.1)
• Pfam: ATP synthase (E/31 kDa) subunit (PF01991.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;