Protein coding transcript 30597

• Transcript: Ll_transcript_512023
• CDS coordinates: 291-1058 (+)
• Peptide sequence: MTGKAAAPLMKLVRLKGVPILQQLHLEEQLLRTSSDNWCLINDGTISPAIVMGLSGKISELVELKSVLRDHIPIIRRFTGGGTVIVDHDTIFVTLICNKDAVSNVQPFPRPIMTWSGLLYNKVFEGVADFHLRENDYVFGDRKFGGNAQSITKHRWVHHTSFLWDYEAKNMSYLKLPSKAPEYRLTRGHVDFIRGMKDYLPRSEFIERTIKAIGAQFSVKSISLESIDIPSASEFVHTTKLLTEQEIQEACNVQT*
• ORF Type: complete

Annotations of Ll_transcript_512023

• Blastp: Putative lipoate-protein ligase A from Schizosaccharomyces with 27.05% of identity
• Blastx: Probable lipoate-protein ligase A from Mycoplasma with 28.93% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC17A3.09c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438233.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;