Protein coding transcript 30600

• Transcript: Ll_transcript_512039
• CDS coordinates: 181-747 (+)
• Peptide sequence: MTGKAAAPLMKLVRLKGVPILQQLHLEEQLLRTSSDNWCLINDGTISPAIVMGLSGKISELVELKSVLRDHIPIIRRFTGGGTVIVDHDTIFVTLICNKDAVSNVQPFPRPIMTWSGLLYNKVFEGVADFHLRENDYVFGDRKFGGNAQSITKHRWVHHTSFLWDYEAKNMSYLKLPSKAPEYRLVSL*
• ORF Type: complete

Annotations of Ll_transcript_512039

• Blastp: Lipoate-protein ligase LplJ from Bacillus with 30.58% of identity
• Blastx: Lipoate-protein ligase LplJ from Bacillus with 30.58% of identity
• Eggnog: Lipoate-protein, ligase(COG0095)
• Kegg: Link to kegg annotations (BSU10250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438233.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;