Protein coding transcript 30631

• Transcript: Ll_transcript_513480
• CDS coordinates: 150-674 (+)
• Peptide sequence: MYSIVNPFFFSVVLLNAIHASSQASSSPPLMILGCGLDKGSEKDVDGRTWGPDDKFLQPGGNSIKSKASFQDPSLLDVVPYMSARVFTSETSYKFPVQPDKRYWLRLHFYPSVYGSYNPSESYFSVIANGGVTLLSNFSASITCQALSQAYLDREYSLAPLNTDALTLTFKPNDK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_513480

• Blastp: Receptor-like protein kinase ANXUR1 from Arabidopsis with 57.24% of identity
• Blastx: Receptor-like protein kinase ANXUR1 from Arabidopsis with 57.24% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G04690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425109.1)
• Pfam: Carbohydrate-binding protein of the ER (PF12819.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;