Protein coding transcript 30637

• Transcript: Ll_transcript_513731
• CDS coordinates: 891-1232 (+)
• Peptide sequence: MRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK*
• ORF Type: complete

Annotations of Ll_transcript_513731

• Blastp: Calmodulin from Medicago with 100% of identity
• Blastx: Calmodulin from Medicago with 94.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001037)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004491196.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;