Protein coding transcript 30643

• Transcript: Ll_transcript_512104
• CDS coordinates: 234-677 (+)
• Peptide sequence: MATQNSQIYHENQSLQFCLLHTLNSLFQPHHNVLTGNYDVNVLIAALEDRGKSVIWHDRRNGVSSIDLDAPQDVLMGIVLNVPVRRFAGIWKSRHWVALRKIDGVWYNLDSDLHAPQRFRDIQKVREFLGSTIGHGGEVLLVMNQKQ*
• ORF Type: complete

Annotations of Ll_transcript_512104

• Blastp: Josephin-like protein from Arabidopsis with 56.1% of identity
• Blastx: Josephin-like protein from Arabidopsis with 56.1% of identity
• Eggnog: Josephin domain containing(ENOG4111I4J)
• Kegg: Link to kegg annotations (AT2G29640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431779.1)
• Pfam: Josephin (PF02099.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;