Protein coding transcript 30650

• Transcript: Ll_transcript_512109
• CDS coordinates: 107-610 (+)
• Peptide sequence: MSSGGGGGGAGGGSSNYRVPIPDNVRKTIHNIREITGKQHTDDEIYAVLRDCSMDPNETAQKLLYLDTFHEVKRRRDRNKEGLSSRASGDSRSKQGGQGRGGRGASRGYSSDFHDGGGMRNPAIRKENGVNHIAERSHAPSTQPALLKTKTNTASQATRLQFHSYFL*
• ORF Type: complete

Annotations of Ll_transcript_512109

• Blastp: GBF-interacting protein 1 from Arabidopsis with 44.36% of identity
• Blastx: GBF-interacting protein 1 from Arabidopsis with 42.52% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G13222)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435702.1)
• Pfam: Protein of unknown function (DUF1296) (PF06972.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;