Protein coding transcript 30680

• Transcript: Ll_transcript_513656
• CDS coordinates: 289-831 (+)
• Peptide sequence: MFLKVQLPWNVIIAAENLQPESLMLQRSIVICLLSDFAIKKATKDLGYYLAVTTLETIGEGKVRLHTGDVLFPVVFNAITFKILKGEILEGVVHKVLKHGVFMRCGPIENVYLSNLKMPGYHYVPGENPCFMNEKMSKVGKDVRVRFVVIGTKWMEAEREFQALVSLEGDYLGPISSPDI*
• ORF Type: complete

Annotations of Ll_transcript_513656

• Blastp: DNA-directed RNA polymerase V subunit 7 from Arabidopsis with 72.32% of identity
• Blastx: DNA-directed RNA polymerase V subunit 7 from Arabidopsis with 72.73% of identity
• Eggnog: DNA-directed RNA Polymerase(COG1095)
• Kegg: Link to kegg annotations (AT4G14660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424512.1)
• Pfam: SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397 (PF03876.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;