| Transcript | Ll_transcript_512709 |
|---|---|
| CDS coordinates | 308-754 (+) |
| Peptide sequence | MKNERVVSGTMLVERNTYHRPKVGATLHSDPTSLYSPDHNDDDDYSTTRHSNVSAATPTGSSSNASPLMMSPWNQVHDTSSPYNKSPWLLTSSAINLFNHPEDEDNNDNSNQLENGLIGSLVREEGHIYSLAVSGGLLYTGSDSKNIRV |
| ORF Type | 3prime_partial |
| Blastp | Protein JINGUBANG from Arabidopsis with 41.26% of identity |
|---|---|
| Blastx | Protein JINGUBANG from Arabidopsis with 41.26% of identity |
| Eggnog | wd repeat(COG2319) |
| Kegg | Link to kegg annotations (AT2G26490) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454156.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer