Protein coding transcript 30697

• Transcript: Ll_transcript_512720
• CDS coordinates: 346-693 (+)
• Peptide sequence: MLNVVIGANRGIGFSICKQLASVVVTPRDEMVGLEAIEKLKQLHVTDPASIRLLEDFIRIQLDISVCITNLYLYLHMSIALCLVKVLEHKSGFTFIIIQVNRFLQAFVHFQLYIC*
• ORF Type: complete

Annotations of Ll_transcript_512720

• Blastp: B3 domain-containing protein At2g33720 from Arabidopsis with 32.59% of identity
• Blastx: B3 domain-containing protein At2g33720 from Arabidopsis with 32.59% of identity
• Eggnog: Transcription factor(ENOG4111D7C)
• Kegg: Link to kegg annotations (AT2G33720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421579.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;