Transcript | Ll_transcript_412793 |
---|---|
CDS coordinates | 2-313 (+) |
Peptide sequence | AKRRRLTTSSSFDHRMETKLHRVPGRLFLNGSTQVASYYCKQGRKGINQDAILLWENFYSKGDTILCGVFDGHGPNGHMVSKKVRDSFPLKLIAQWDLLSNNKD |
ORF Type | internal |
Blastp | Probable protein phosphatase 2C 33 from Arabidopsis with 66.67% of identity |
---|---|
Blastx | Probable protein phosphatase 2C 33 from Arabidopsis with 62.89% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AT3G02750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441580.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer