| Transcript | Ll_transcript_412793 |
|---|---|
| CDS coordinates | 2-313 (+) |
| Peptide sequence | AKRRRLTTSSSFDHRMETKLHRVPGRLFLNGSTQVASYYCKQGRKGINQDAILLWENFYSKGDTILCGVFDGHGPNGHMVSKKVRDSFPLKLIAQWDLLSNNKD |
| ORF Type | internal |
| Blastp | Probable protein phosphatase 2C 33 from Arabidopsis with 66.67% of identity |
|---|---|
| Blastx | Probable protein phosphatase 2C 33 from Arabidopsis with 62.89% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT3G02750) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441580.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer