Protein coding transcript 30718

• Transcript: Ll_transcript_511869
• CDS coordinates: 1784-2272 (+)
• Peptide sequence: MKDTTNSCMVVAALIATVVFAALLTVPGGNNQDKGIPIFLSDNTLMLYVVSDALALFSSMASLLMFLSILTARYAEEDFLKTLPERLILGLASLFFAIITTMIAFVAALTLVLRERVKWVSIPFALLACVPVGLFARLQLPLFIQMIISTYGSRIYHPQSLW*
• ORF Type: complete

Annotations of Ll_transcript_511869

• Blastp: Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C from Gallus with 30.86% of identity
• Blastx: Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C from Gallus with 31.06% of identity
• Eggnog: Ankyrin Repeat(COG0666)
• Kegg: Link to kegg annotations (426469)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447107.1)
• Pfam: -
• Rfam: -
• GO: -