Transcript | Ll_transcript_511813 |
---|---|
CDS coordinates | 620-1078 (+) |
Peptide sequence | MQCVMDAIPASAVEPGGVAPTQTQFLHSRIDTSPSIPFFRSKSTRIENLQSLPLTSQNEGTLVLRNKSPRWHEQLQCWCLNFNGRVTVASVKNFQLVASPKNGVSEQAQETVILQFGKVGKDVFTMDYQYPISAFEAFAICLSSFDTKIACE* |
ORF Type | complete |
Blastp | Tubby-like F-box protein 3 from Arabidopsis with 77.78% of identity |
---|---|
Blastx | Tubby-like F-box protein 6 from Oryza sativa with 66.2% of identity |
Eggnog | tubby like protein(ENOG410XQFT) |
Kegg | Link to kegg annotations (AT2G47900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441787.1) |
Pfam | Tub family (PF01167.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer