Transcript | Ll_transcript_511821 |
---|---|
CDS coordinates | 3-632 (+) |
Peptide sequence | LMPKQHLSGELHFSNNTPFCNASAEALNDIRAGVFSSSKAQYQTPTFEEKPISPSTQLSKLKKDESPDTISVGKKSGCEPAFKRQRIETPSPLPTFKVRKEKLGDRITALQQLVSPFGKTDTASVLHEAIDYIKFLHDQVTVLNTSYLKKGAPIQHQQRCDNLNDSEGPKQDLRSRGLCLVPISSTFPVVNETSVDFWTLTFGGAFISS* |
ORF Type | 5prime_partial |
Blastp | Transcription factor bHLH123 from Arabidopsis with 51.22% of identity |
---|---|
Blastx | Transcription factor bHLH123 from Arabidopsis with 51.22% of identity |
Eggnog | Transcription factor(ENOG4111AEF) |
Kegg | Link to kegg annotations (AT3G20640) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424710.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer