Protein coding transcript 30740

• Transcript: Ll_transcript_511822
• CDS coordinates: 2-835 (+)
• Peptide sequence: MNQGFCLNQQGLSSVTSIGQSCGFQIESTSSYDYPSNLTQSLYEPAYPQPQPQNSLFNNPSTMSYSSAPNYGTSSSNELSPTTWSKVPNSFVQKQQHSSGLHFSNKTPFWNASAEALNDITAGVFASSQAQYQAPTFEDKPISQNTLLNKLKEDDKSSNTISVGKKSACEPDFKRPRIETPSSLPTFKVRKEKLGDRVTALQQLVSPFGKVLTTSYLNNGSPNEYQGCDNVNNSEGPNQDLRSQGLCLVPISSTFPVTNETTIDFWTPTFGGTFNIS*
• ORF Type: complete

Annotations of Ll_transcript_511822

• Blastp: Transcription factor bHLH112 from Arabidopsis with 43.08% of identity
• Blastx: Transcription factor bHLH112 from Arabidopsis with 43.08% of identity
• Eggnog: Whole genome shotgun sequence of line PN40024, scaffold_274.assembly12x (Fragment)(ENOG410YDUV)
• Kegg: Link to kegg annotations (AT1G61660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419072.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;