Protein coding transcript 30807

• Transcript: Ll_transcript_513358
• CDS coordinates: 242-892 (+)
• Peptide sequence: MLKLWKWYQKCMIIHPVKTQVISSGVIWGVGDIAAQFVTHSIPNKTISKFKDDNKEFKINWKRVATTSLFGLGFVGPVGHYWYEYLDRFIRLKLLLKPNSFRFVASKVAIDGLIFGPFDLLMFFTYMGFCNGKSVPQIKEDVKRDFLPAFVLEGSIWPIVQVGNFRFIPVRYQLLYVNFFCLLDSCFLSWVEQQEDAQWKQWVKSFLPLEEHKRQG*
• ORF Type: complete

Annotations of Ll_transcript_513358

• Blastp: PXMP2/4 family protein 2 from Dictyostelium with 32.34% of identity
• Blastx: PXMP2/4 family protein 2 from Dictyostelium with 32.2% of identity
• Eggnog: Peroxisomal membrane protein(ENOG4111SYH)
• Kegg: Link to kegg annotations (DDB_G0278529)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417009.1)
• Pfam: Mpv17 / PMP22 family (PF04117.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;