| Transcript | Ll_transcript_512341 |
|---|---|
| CDS coordinates | 164-544 (+) |
| Peptide sequence | MAEAKPRAILEEMVKSNNLLSISNIKSHLQKCRTTINIHKEERSEEGHRTKGVIELQDKIHKQIEDSQKLQLEIGKSIHQQLEMQRNLQVLIQQQRKQLKILLNNQKERNRLEKILDTELDMTDSE* |
| ORF Type | complete |
| Blastp | Myb family transcription factor PHL5 from Arabidopsis with 36% of identity |
|---|---|
| Blastx | - |
| Eggnog | Myb-like DNA-binding domain(ENOG410YGDG) |
| Kegg | Link to kegg annotations (AT5G06800) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439135.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer