Protein coding transcript 30813

• Transcript: Ll_transcript_512352
• CDS coordinates: 84-386 (+)
• Peptide sequence: MEGDKLVLRGLAFHGFHGVKAEERTLGQKFLVDIDAWMDLIPAATSDDLSLTISYTHIYRSHSHSSFLCLYILKLNRARCWVYPGVKLFILDMRHVLKSL*
• ORF Type: complete

Annotations of Ll_transcript_512352

• Blastp: Dihydroneopterin aldolase 1 from Arabidopsis with 66.67% of identity
• Blastx: Dihydroneopterin aldolase 1 from Arabidopsis with 66.67% of identity
• Eggnog: dihydroneopterin aldolase(COG1539)
• Kegg: Link to kegg annotations (AT3G11750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424764.1)
• Pfam: Dihydroneopterin aldolase (PF02152.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;