Transcript | Ll_transcript_512353 |
---|---|
CDS coordinates | 781-1113 (+) |
Peptide sequence | MMIVNRLGGPQKAKPKAILEEMIKSDNLLSISHVKSHLQKCRTTINMHKAMQERSEEGHITDGVTDLQIKIHMQIEESRKLQLEVRKSIHQQLEVTKEYRISHFLCLIMF* |
ORF Type | complete |
Blastp | Protein PHOSPHATE STARVATION RESPONSE 1 from Oryza sativa with 41.84% of identity |
---|---|
Blastx | Protein PHOSPHATE STARVATION RESPONSE 1 from Oryza sativa with 40% of identity |
Eggnog | Myb-like DNA-binding domain containing protein, expressed(ENOG410YG61) |
Kegg | Link to kegg annotations (4332726) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418724.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer