Transcript | Ll_transcript_512357 |
---|---|
CDS coordinates | 84-464 (+) |
Peptide sequence | MEGDKLVLRGLAFHGFHGVKAEERTLGQKFLVDIDAWMDLIPAATSDDLSLTISYTHIYRIAKEVLEGPPQNLLESVAHRIAITTLTNYEQISAIRVKVGKPHVAVQGTLDYLGVEIFRNRTHLHS* |
ORF Type | complete |
Blastp | Dihydroneopterin aldolase 1 from Arabidopsis with 61.16% of identity |
---|---|
Blastx | Dihydroneopterin aldolase 1 from Arabidopsis with 61.16% of identity |
Eggnog | dihydroneopterin aldolase(COG1539) |
Kegg | Link to kegg annotations (AT3G11750) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424764.1) |
Pfam | Dihydroneopterin aldolase (PF02152.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer