Protein coding transcript 30819

• Transcript: Ll_transcript_512330
• CDS coordinates: 781-1194 (+)
• Peptide sequence: MMIVNRLGGPQKAKPKAILEEMIKSDNLLSISHVKSHLQKCRTTINMHKAMQERSEEGHITDGVTDLQIKIHMQIEESRKLQLEVRKSIHQQLEMQRNLQVLIQQQGKQLKTMLHNQKERTKLEKILGTELYVNDSE*
• ORF Type: complete

Annotations of Ll_transcript_512330

• Blastp: Myb family transcription factor PHL5 from Arabidopsis with 47.41% of identity
• Blastx: Myb family transcription factor PHL5 from Arabidopsis with 49.62% of identity
• Eggnog: Myb-like DNA-binding domain(ENOG410YGDG)
• Kegg: Link to kegg annotations (AT5G06800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418724.1)
• Pfam: MYB-CC type transfactor, LHEQLE motif (PF14379.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;