Protein coding transcript 30824

• Transcript: Ll_transcript_512337
• CDS coordinates: 307-657 (+)
• Peptide sequence: MIKSDNLLSISHVKSHLQKCRTTINMHKAMQERSEEGHITDGVTDLQIKIHMQIEESRKLQLEVRKSIHQQLEMQRNLQVLIQQQGKQLKTMLHNQKERTKLEKILGTELYVNDSE*
• ORF Type: complete

Annotations of Ll_transcript_512337

• Blastp: Protein PHOSPHATE STARVATION RESPONSE 1 from Oryza sativa with 44.94% of identity
• Blastx: Myb family transcription factor PHL5 from Arabidopsis with 44.44% of identity
• Eggnog: Myb-like DNA-binding domain containing protein, expressed(ENOG410YG61)
• Kegg: Link to kegg annotations (4332726)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418724.1)
• Pfam: MYB-CC type transfactor, LHEQLE motif (PF14379.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;