Protein coding transcript 30865

• Transcript: Ll_transcript_512557
• CDS coordinates: 431-1027 (+)
• Peptide sequence: MARRRWLAALAITVSVLFGDIADSFDGGGHPKQQLSMCAELILPAGYPCSEYMIETKDGFLLGLQRVSSSSYLRFGSAPQRGPPVLLQHGLFMAGDAWFLNNPEESLGFILADHGFDVWVGNVRGTRWSHGHISLSEKKKKFWDWSWEELALYDLAEMINYINSVTNSKLFVVGHSQVFIILVHHSPLPHPTAVWWLL*
• ORF Type: complete

Annotations of Ll_transcript_512557

• Blastp: Triacylglycerol lipase 1 from Arabidopsis with 58.06% of identity
• Blastx: Triacylglycerol lipase 1 from Arabidopsis with 59.22% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (AT2G15230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441481.1)
• Pfam: Partial alpha/beta-hydrolase lipase region (PF04083.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;