Transcript | Ll_transcript_512557 |
---|---|
CDS coordinates | 431-1027 (+) |
Peptide sequence | MARRRWLAALAITVSVLFGDIADSFDGGGHPKQQLSMCAELILPAGYPCSEYMIETKDGFLLGLQRVSSSSYLRFGSAPQRGPPVLLQHGLFMAGDAWFLNNPEESLGFILADHGFDVWVGNVRGTRWSHGHISLSEKKKKFWDWSWEELALYDLAEMINYINSVTNSKLFVVGHSQVFIILVHHSPLPHPTAVWWLL* |
ORF Type | complete |
Blastp | Triacylglycerol lipase 1 from Arabidopsis with 58.06% of identity |
---|---|
Blastx | Triacylglycerol lipase 1 from Arabidopsis with 59.22% of identity |
Eggnog | Alpha beta hydrolase(COG0596) |
Kegg | Link to kegg annotations (AT2G15230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441481.1) |
Pfam | Partial alpha/beta-hydrolase lipase region (PF04083.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer