Protein coding transcript 30886

• Transcript: Ll_transcript_511674
• CDS coordinates: 1-423 (+)
• Peptide sequence: VGTYGYMSSEYAMYGRFSEKSDVFSFGVILLEIISAKRNTHSILSDDVEYLLSYAWRQWRDQTPIEILDQDIKECCNESEVIKCIQVGLLCVQDKADDRPTMAKVVSYFSNSDSEAVLPFPGEPINSMHDQILQKTVAAGE
• ORF Type: internal

Annotations of Ll_transcript_511674

• Blastp: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 42.86% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 47.58% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G23180)
• CantataDB: Link to cantataDB annotations (CNT0000159)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427245.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;