Protein coding transcript 30889

• Transcript: Ll_transcript_511676
• CDS coordinates: 67-390 (+)
• Peptide sequence: MYLGWNLDTGIEKHITSWKINGQDPSTGDYSFKMNYHGLPEIFLWNNKEVIYRSGPWNGDRFSGVPEMQPDTDSINFTFTANQHEVYYSFSIMNQSLFSRPSVTSDGE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_511676

• Blastp: Receptor-like serine/threonine-protein kinase SD1-8 from Arabidopsis with 54.21% of identity
• Blastx: Receptor-like serine/threonine-protein kinase SD1-8 from Arabidopsis with 55.75% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G21380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426373.1)
• Pfam: S-locus glycoprotein domain (PF00954.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;