Protein coding transcript 30992

• Transcript: Ll_transcript_512605
• CDS coordinates: 180-542 (+)
• Peptide sequence: MEFFNWINLFMIFSLFSLSISTNFLEEAKNGDVFDWMVKIRRKIHENPELGYEEFKTSEVIRTELGKLGIPYRHDQVAVTAVIAFIGTQKPPFLALRADMDALPMQVTKGGAYKKDSNKK*
• ORF Type: complete

Annotations of Ll_transcript_512605

• Blastp: IAA-amino acid hydrolase ILR1-like 2 from Arabidopsis with 68.97% of identity
• Blastx: IAA-amino acid hydrolase ILR1-like 2 from Arabidopsis with 70.37% of identity
• Eggnog: amidohydrolase(COG1473)
• Kegg: Link to kegg annotations (AT5G56660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457105.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;