Protein coding transcript 30997

• Transcript: Ll_transcript_512596
• CDS coordinates: 1926-2363 (+)
• Peptide sequence: MMQLRRRIEQVIIGQAAVQRCNATVSFLDKENPYFPPTVNTDDLHDYFKSVAGSVLGVDKVKEIQPMMGSEDFSFYQEVIPGYFFLLGMVNSSVEHLESAHSPYFKVNEDALPYGAALHASLSARYLLKLHQDVPVVEGKYNDEL*
• ORF Type: complete

Annotations of Ll_transcript_512596

• Blastp: IAA-amino acid hydrolase ILR1-like 4 from Arabidopsis with 59.69% of identity
• Blastx: IAA-amino acid hydrolase ILR1-like 4 from Arabidopsis with 78.15% of identity
• Eggnog: amidohydrolase(COG1473)
• Kegg: Link to kegg annotations (AT1G51760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448193.1)
• Pfam: Peptidase family M20/M25/M40 (PF01546.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;