Transcript | Ll_transcript_395348 |
---|---|
CDS coordinates | 2-334 (+) |
Peptide sequence | FPLGQPLVLKVHPPATYTVGGAGGWTFNTNGWPKGKRFRAGDRLVFNYGRGAHNVAVVNKGGYAGCNTPRGSKVYRSGKDQITLSRGMNYFICSFVGHCQFGMKIAIYAP* |
ORF Type | 5prime_partial |
Blastp | Basic blue protein from Cucumis with 68.42% of identity |
---|---|
Blastx | Basic blue protein from Cucumis with 68.42% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461867.1) |
Pfam | Plastocyanin-like domain (PF02298.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer