Protein coding transcript 31034

• Transcript: Ll_transcript_512772
• CDS coordinates: 156-473 (+)
• Peptide sequence: MVFFKCQSISTMPCQIAHFCVYHGVHMAKEHRLSSFPNSSKGYQYLDACLLLIFFASRGSFDIEFDLTKPPRAFHSSFSSKSTLPSTVSVSSFLVDFERRNWCLL*
• ORF Type: complete

Annotations of Ll_transcript_512772

• Blastp: Probable protein phosphatase 2C 52 from Arabidopsis with 36.29% of identity
• Blastx: Probable protein phosphatase 2C 18 from Arabidopsis with 38.79% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT4G03415)
• CantataDB: Link to cantataDB annotations (CNT0001559)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459808.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;