Transcript | Ll_transcript_357378 |
---|---|
CDS coordinates | 1-297 (+) |
Peptide sequence | PVQVTGQLAGLTKGLHGFHVHEFGDNTNGCTSAGPHFNPQGKDHGAPTDADRHVGDLGNVEAGVDGVAKIQISDKLISLTGPNSIIGRTVVVHADPDDL |
ORF Type | internal |
Blastp | Superoxide dismutase [Cu-Zn] from Ceratitis with 75.76% of identity |
---|---|
Blastx | Superoxide dismutase [Cu-Zn] from Ceratitis with 75.76% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003626362.1) |
Pfam | Copper/zinc superoxide dismutase (SODC) (PF00080.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer