| Transcript | Ll_transcript_511934 |
|---|---|
| CDS coordinates | 2239-2565 (+) |
| Peptide sequence | MKYDINVTEIITLLAPENFQYCGYVIYIMVSCREACINFLDLCKQKNEDKLWMDEIAAMQASAQPILPYLRTSGIILAGEDDNNSKPNGLVDASISDSTASLGSLDIGQ |
| ORF Type | 3prime_partial |
| Blastp | COP1-interacting protein 7 from Arabidopsis with 48.78% of identity |
|---|---|
| Blastx | COP1-interacting protein 7 from Arabidopsis with 68.35% of identity |
| Eggnog | NA(ENOG4111427) |
| Kegg | Link to kegg annotations (AT4G27430) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019443964.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer