Protein coding transcript 31190

• Transcript: Ll_transcript_513183
• CDS coordinates: 1229-1654 (+)
• Peptide sequence: MISLGKEGYLKNTKEIMEASKQIEKGVEEISELFVVGRPDMTIVAFGSDVLDIFEVNDIMSSKGWHLNALQRPNSIHICVTLQHVPVVENFLGDLKESVKTVKENPGPIKGGLAPIYGAAGKMPDRGTVQELLVEYMDGTC*
• ORF Type: complete

Annotations of Ll_transcript_513183

• Blastp: Sphingosine-1-phosphate lyase from Arabidopsis with 80.43% of identity
• Blastx: Sphingosine-1-phosphate lyase from Arabidopsis with 82.25% of identity
• Eggnog: decarboxylase(COG0076)
• Kegg: Link to kegg annotations (AT1G27980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453056.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;