Protein coding transcript 31230

• Transcript: Ll_transcript_513133
• CDS coordinates: 61-1179 (+)
• Peptide sequence: MRFCPNLNWKNLFTKSRNFAASFQRASTTSSYSSSAAAMSNLQILKTKLCIIGSGPAAHTAAVYAARAELKPILFEGWMANDIAPGGQLTTTTDVENFPGFPDGILGGELMDRCRKQSERVGTEIYTETVSKVDFSNRPFKVFTDAKVVEADSVVVATGAVAKKLPFIGSGDGPDGFWNRGISACAVCDGAAPIFRNKPLAVIGGGDSAMEEATFLTKYGSEVHIIHRRNSFRASKIMQARALDNKKIKVIWNSVVVKAYGDENNQRVLGGLRIKNVETGVESDLKVSGLFFAIGHEPATKFLDGQLELDSDGYVVTKPGTTKTSIDGVFAAGDVQDKKYRQAITAAGSGCMAALDAEHYLQEIGSQQDKSD*
• ORF Type: complete

Annotations of Ll_transcript_513133

• Blastp: Thioredoxin reductase 2 from Arabidopsis with 81.02% of identity
• Blastx: Thioredoxin reductase 2 from Arabidopsis with 81.02% of identity
• Eggnog: thioredoxin reductase(COG0492)
• Kegg: Link to kegg annotations (AT2G17420)
• CantataDB: Link to cantataDB annotations (CNT0002325)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424108.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;