Protein coding transcript 31303

• Transcript: Ll_transcript_512194
• CDS coordinates: 121-429 (+)
• Peptide sequence: MDRVRDLASKKAAVIFTKSSCCMCHSIKQLFYELGASPEVHELDNDSYGKEMEWAIRSLGCNPSVPAVFIGGRFVGSSKDMISLHVDGSLKQMLMDAKAIWL*
• ORF Type: complete

Annotations of Ll_transcript_512194

• Blastp: Glutaredoxin-C11 from Arabidopsis with 77.67% of identity
• Blastx: Glutaredoxin-C11 from Arabidopsis with 77.67% of identity
• Eggnog: Glutaredoxin(COG0695)
• Kegg: Link to kegg annotations (AT3G62950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418151.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;