Protein coding transcript 31316

• Transcript: Ll_transcript_512475
• CDS coordinates: 257-646 (+)
• Peptide sequence: MEWGNFRSSHLLLTEYDQALDAESLNPGEQIFEKLISGMYLGEIVRRALLKMAEEAEFFGDTVPPKLRVPFILRTPDMSAMHHDTSPDLKVVGNKLRDIFEISNTSVKTRKVVVELCNIVATRGARRAAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_512475

• Blastp: Hexokinase-1 from Nicotiana with 77.69% of identity
• Blastx: Hexokinase-1 from Nicotiana with 78.2% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107797523)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431554.1)
• Pfam: Hexokinase (PF03727.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;