Transcript | Ll_transcript_512485 |
---|---|
CDS coordinates | 1-336 (+) |
Peptide sequence | MVINTEWGNFGSTHLPLTEYDQALDAESLNPGEQIYEKLISGMYLGDIVRRVLLKLAEEADFFGDTVPPKLRVPFIIRTPDMSAMHHDTSPDLKVVGNKFRDILEISNTSLK |
ORF Type | 3prime_partial |
Blastp | Hexokinase-2 from Arabidopsis with 77.68% of identity |
---|---|
Blastx | Hexokinase-2 from Arabidopsis with 77.68% of identity |
Eggnog | hexokinase(COG5026) |
Kegg | Link to kegg annotations (AT2G19860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446376.1) |
Pfam | Hexokinase (PF03727.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer