Transcript | Ll_transcript_395344 |
---|---|
CDS coordinates | 2-298 (+) |
Peptide sequence | VIPRTLAESAGLDATEVLARLYTAHYSYQQQQNSKKTDSSSEDESPIAIGVDIENEDGTGTLDAEEEGILDLMVSKSWAIKLATESVRTILSVDQIIVA |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Probable T-complex protein 1 subunit theta from Schizosaccharomyces with 43.43% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPBC337.05c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014492480.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer