| Transcript | Ll_transcript_395344 |
|---|---|
| CDS coordinates | 2-298 (+) |
| Peptide sequence | VIPRTLAESAGLDATEVLARLYTAHYSYQQQQNSKKTDSSSEDESPIAIGVDIENEDGTGTLDAEEEGILDLMVSKSWAIKLATESVRTILSVDQIIVA |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Probable T-complex protein 1 subunit theta from Schizosaccharomyces with 43.43% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC337.05c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014492480.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer